PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_461761g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family ZF-HD
Protein Properties Length: 265aa    MW: 29204.4 Da    PI: 7.7777
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_461761g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer109.42e-3452108259
     ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                     ++vrY+eC+kNhAas+Ggha+DGCgEfmps g+egt +alkCaAC+CHRnFHRreve 
  MA_461761g0010  52 KSVRYRECMKNHAASIGGHAIDGCGEFMPS-GDEGTLEALKCAACNCHRNFHRREVEG 108
                     679**************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-2351112IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.0E-3154106IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.4E-3155106IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152328.22756105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.37E-10177232IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.3E-21180232IPR009057Homeodomain-like
TIGRFAMsTIGR015652.6E-19186232IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MELGGQEEEI GMPISVSYGP IHESSKLKIL TPGGNGAASD EQQQQQQAAA KKSVRYRECM  60
KNHAASIGGH AIDGCGEFMP SGDEGTLEAL KCAACNCHRN FHRREVEGEP PCYYCYNPRK  120
DSRKRPAGSP LPLALPSTSP PGVIARPSPQ MIMAFGSGPT HENDQQEHDM ALHGLHGASM  180
AMPIMKKRFR TKFTQEQKDK MCSFAEKLGW RIQKHDEAAV QQFCMELGVK RHLSLLISDS  240
LSVTHMKPSV EVKSMELLGS FKEPI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-181872331864ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1243410.0BT124341.1 Picea sitchensis clone WS0473_C24 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009403385.11e-65PREDICTED: zinc-finger homeodomain protein 4-like
RefseqXP_009403391.11e-65PREDICTED: zinc-finger homeodomain protein 4-like
RefseqXP_009403399.11e-65PREDICTED: zinc-finger homeodomain protein 4-like
SwissprotO647223e-53ZHD3_ARATH; Zinc-finger homeodomain protein 3
TrEMBLD5ADH81e-175D5ADH8_PICSI; Putative uncharacterized protein
STRINGPP1S230_85V6.13e-68(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02540.15e-54homeobox protein 21